TMEM72 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM72 Polyclonal antibody, PBS Only (28049-1-PBS)

• 

  IHC staining of human kidney using 28049-1-AP (same clone as 28049-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28049-1-AP (TMEM72 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28049-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 28049-1-AP (same clone as 28049-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 28049-1-AP (TMEM72 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28049-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 28049-1-AP (same clone as 28049-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28049-1-AP (TMEM72 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28049-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 28049-1-AP (same clone as 28049-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 28049-1-AP (TMEM72 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28049-1-PBS in a different storage buffer formulation.

TMEM72 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 28049-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

28049-1-PBS targets TMEM72 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21553

  Product name: Recombinant human TMEM72 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 120-275 aa of BC127790

  Sequence: LIITGLAYFLLSKRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSALQPPNTLMELSLEPADSLAKKKQVHFEDNLVRIVPSLAEGLDDGDSEPEETTSDTTPIIPPPQAPLFLSSLTATGLF

• Full Name: transmembrane protein 72
• Calculated Molecular Weight: 275 aa, 30 kDa
• GenBank Accession Number: BC127790
• Gene Symbol: TMEM72
• Gene ID (NCBI): 643236
• RRID: AB_3086025
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A0PK05
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.