TMEM74 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM74 Polyclonal antibody, PBS Only (25506-1-PBS)

• 

  IHC staining of mouse brain using 25506-1-AP (same clone as 25506-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 25506-1-AP (TMEM74 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25506-1-PBS in a different storage buffer formulation.

TMEM74 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 25506-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Transmembrane protein 74, NET36

---

Product Information

25506-1-PBS targets TMEM74 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22288

  Product name: Recombinant human TMEM74 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC030710

  Sequence: MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKLSSSPASPSSSLQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINLEQRNRSSPSAKGHNHPGELGWENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFISAILFLVT

• Full Name: transmembrane protein 74
• Calculated Molecular Weight: 305 aa, 33 kDa
• GenBank Accession Number: BC030710
• Gene Symbol: TMEM74
• Gene ID (NCBI): 157753
• RRID: AB_3742149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96NL1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transmembrane protein 74 (TMEM74), plays an essential role in autophagy during cell starvation and other stress conditions. TMEM74 is localized to the lysosome and autophagosome. It has been reported that TMEM74-induced autophagy may be associated with PI3K signal transduction. (PMID: 19029833, 18294959)