TMEM77 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TMEM77 Polyclonal antibody, PBS Only (23182-1-PBS)

• 

  WB analysis using 23182-1-AP (same clone as 23182-1-PBS)

  K-562 cells lysate was subjected to SDS PAGE followed by western blot with 23182-1-AP (TMEM77 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 23182-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovarian cancer using 23182-1-AP (same clone as 23182-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 23182-1-AP (TMEM77 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23182-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 23182-1-AP (same clone as 23182-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 23182-1-AP (TMEM77 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23182-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 23182-1-AP (same clone as 23182-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 23182-1-AP (TMEM77 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23182-1-PBS in a different storage buffer formulation.

TMEM77 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 23182-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

DNA damage-regulated autophagy modulator protein 2, DRAM2, PRO180, UNQ154/PRO180

---

Product Information

23182-1-PBS targets TMEM77 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19711

  Product name: Recombinant human TMEM77 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 170-266 aa of BC047025

  Sequence: ALSMLTCSSVLHSGNFGTDLEQKLHWNPEDKGYVLHMITTAAEWSMSFSFFGFFLTYIRDFQKISLRVEANLHGLTLYDTAPCPINNERTRLLSRDI

• Full Name: transmembrane protein 77
• Calculated Molecular Weight: 266 aa, 30 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC047025
• Gene Symbol: TMEM77
• Gene ID (NCBI): 128338
• RRID: AB_2879225
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q6UX65
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.