FDX1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82957-2-RR (same clone as 82957-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82957-2-RR (FDX1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82957-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 82957-2-RR (same clone as 82957-2-PBS)

  WB result of FDX1 antibody (82957-2-RR; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-FDX1 transfected HEK-293 cells. This data was developed using the same antibody clone with 82957-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 82957-2-RR (same clone as 82957-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82957-2-RR (FDX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82957-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 82957-2-RR (same clone as 82957-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 82957-2-RR (FDX1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer(pH9). This data was developed using the same antibody clone with 82957-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 82957-2-RR (same clone as 82957-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 82957-2-RR (FDX1 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 82957-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 82957-2-RR (same clone as 82957-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using FDX1 antibody (82957-2-RR, Clone: 230196E9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 82957-2-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 82957-2-RR (same clone as 82957-2-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.4 ug FDX1 Recombinant antibody (82957-2-RR, Clone:230196E9) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 82957-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 82957-2-RR (same clone as 82957-2-PBS)

  1x10^6 HepG2 cells were intracellularly stained with 0.25 ug FDX1 Recombinant antibody (82957-2-RR, Clone:230196E9) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), or 0.25 ug FDX1 Recombinant antibody (82957-2-RR, Clone: 230196E9) (green). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 82957-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 82957-2-RR

  Biolayer interferometry (BLl) kinetic assays of 82957-2-RR against Human FDX1 were performed. The affinity constant is 17.3 nM.

• Featured Product
• KD/KO Validated

FDX1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 82957-2-PBS

Clone No.230196E9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

Ferredoxin-1, FDX, ADX, 230196E9

---

Product Information

82957-2-PBS targets FDX1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3301

  Product name: Recombinant human FDX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC017063

  Sequence: MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

• Full Name: ferredoxin 1
• Calculated Molecular Weight: 184 aa, 19 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC017063
• Gene Symbol: FDX1
• Gene ID (NCBI): 2230
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10109
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

FDX1(Ferredoxin-1) is also named as ADX, FDX, YAH1, LOH11CR1D and belongs to the adrenodoxin/putidaredoxin family. It is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450 and it can only reduce mitochondrial CYP enzymes that are essential in adrenal steroidogenesis, bile acid formation, and vitamin D synthesis. The full length has a transit peptide of 60 amino acids.