Tested Applications
| Positive WB detected in | HEK-293 cells, A549 cells, PC-3 cells, U-87 MG cells, U-251 cells, HK-2 cells |
| Positive IHC detected in | human stomach cancer tissue, human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | A431 cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
82957-2-RR targets FDX1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag3301 Product name: Recombinant human FDX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC017063 Sequence: MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Predict reactive species |
| Full Name | ferredoxin 1 |
| Calculated Molecular Weight | 184 aa, 19 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC017063 |
| Gene Symbol | FDX1 |
| Gene ID (NCBI) | 2230 |
| RRID | AB_3670701 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P10109 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FDX1(Ferredoxin-1) is also named as ADX, FDX, YAH1, LOH11CR1D and belongs to the adrenodoxin/putidaredoxin family. It is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450 and it can only reduce mitochondrial CYP enzymes that are essential in adrenal steroidogenesis, bile acid formation, and vitamin D synthesis. The full length has a transit peptide of 60 amino acids.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for FDX1 antibody 82957-2-RR | Download protocol |
| IF protocol for FDX1 antibody 82957-2-RR | Download protocol |
| IHC protocol for FDX1 antibody 82957-2-RR | Download protocol |
| WB protocol for FDX1 antibody 82957-2-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FDX1 Recombinant monoclonal antibody (catalog no. 82957-2-RR) has 8 citations. These appear in journals including Free Radical Biology and Medicine, Cell Reports, Journal of Medicinal Chemistry, Scientific Reports, Metabolic Brain Diseases, Computational Biology and Chemistry, and Placenta. The research fields span cuproptosis mechanisms, anti-tumor immunity in renal cell carcinoma, lung adenocarcinoma, colorectal cancer, myocardial ischemia-reperfusion injury, cerebral infarction, and preeclampsia.
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med Targeted Degradation of ATP7B via a Novel Autophagy-Targeting Chimera Promotes Cuproptosis to Potentiate Anti-Tumor Immunity in Clear Cell Renal Cell Carcinoma. | ||
Free Radic Biol Med Phillygenin ameliorates myocardial ischemia-reperfusion injury by inhibiting cuproptosis via the autophagy-lysosome degradation of CTR1 | ||
Cell Rep SIRT5-mediated FDX1 desuccinylation confers cuproptosis resistance in lung adenocarcinoma.
| ||
J Med Chem A Small-Molecule Platform Demonstrates Light-Activated Synergy Between Cuproptosis and Photodynamic Tumor Therapy. | ||
Sci Rep Tanshinone IIA induces oxidative stress in trophoblast cells and enhances copper dependent death | ||
Metab Brain Dis Edaravone dextranol alleviates ferroptosis, Cuproptosis, and blood-brain barrier damage after acute cerebral infarction |
