Product Information
24331-1-PBS targets TMEM9B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19383 Product name: Recombinant human TMEM9B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 80-172 aa of BC040124 Sequence: PDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKV Predict reactive species |
| Full Name | TMEM9 domain family, member B |
| Calculated Molecular Weight | 198 aa, 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC040124 |
| Gene Symbol | TMEM9B |
| Gene ID (NCBI) | 56674 |
| RRID | AB_2879497 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NQ34 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TMEM9B, also termed as Transmembrane protein 9B encodes a 198 amino-acidprotein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites, and three conserved cys-rich domains in the N-terminus. There is a dimer form of TMEM9B protein (PMID: 12359240). TMEM9B mRNA is expressed in a wide range of tissues and cells. TMEM9B is a lysosomal transmembrane protein that regulates the activity of inflammatory signaling pathways.





