Home
Products
Primary Antibodies
TMEM9B Polyclonal antibody, PBS Only (24331-1-PBS)

Filter: AllWBIHC

WB analysis of rat liver using 24331-1-AP (same clone as 24331-1-PBS)
rat liver tissue were subjected to SDS PAGE followed by western blot with 24331-1-AP (TMEM9B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24331-1-PBS in a different storage buffer formulation.
WB analysis of mouse colon using 24331-1-AP (same clone as 24331-1-PBS)
mouse colon tissue were subjected to SDS PAGE followed by western blot with 24331-1-AP (TMEM9B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24331-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 24331-1-AP (same clone as 24331-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 24331-1-AP (TMEM9B Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 24331-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 24331-1-AP (same clone as 24331-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 24331-1-AP (TMEM9B Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 24331-1-PBS in a different storage buffer formulation.

TMEM9B Polyclonal antibody, PBS Only

Name: TMEM9B Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 24331-1-PBS

TMEM9B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24331-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

24331-1-PBS targets TMEM9B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag19383 Product name: Recombinant human TMEM9B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 80-172 aa of BC040124 Sequence: PDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKV Predict reactive species
Full Name	TMEM9 domain family, member B
Calculated Molecular Weight	198 aa, 23 kDa
Observed Molecular Weight	23 kDa, 35 kDa
GenBank Accession Number	BC040124
Gene Symbol	TMEM9B
Gene ID (NCBI)	56674
RRID	AB_2879497
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NQ34
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

TMEM9B, also termed as Transmembrane protein 9B encodes a 198 amino-acidprotein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites, and three conserved cys-rich domains in the N-terminus. There is a dimer form of TMEM9B protein (PMID: 12359240). TMEM9B mRNA is expressed in a wide range of tissues and cells. TMEM9B is a lysosomal transmembrane protein that regulates the activity of inflammatory signaling pathways.