CoraLite® Plus 647 Anti-Human TMIGD2/CD28H Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• CoraLite® Plus 647 Anti-Human TMIGD2/CD28H Rabbit Recombinant Antibody (CL647-98263)

TMIGD2/CD28H Uni-rAb^® Recombinant Antibody for FC

Cat No. CL647-98263 Copied!

Clone No. 241807A5

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

TMIGD2/CD28, 241807A5, CD28 homolog, CD28H, IGPR1

• 

  FC experiment of Transfected HEK-293T using CL647-98263

  1x10^6 HEK-293T cells or TMIGD2/CD28H transfected HEK-293T cells were surface stained with 5 ul CoraLite® Plus 647 Anti-Human TMIGD2/CD28H Rabbit RecAb (CL647-98263, Clone: 241807A5). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Transfected HEK-293T using CL647-98263

  1x10^6 HEK-293T cells or TMIGD2/CD28H transfected HEK-293T cells were surface stained with 5 ul CoraLite® Plus 647 Anti-Human TMIGD2/CD28H Rabbit RecAb (CL647-98263, Clone: 241807A5) (red) or CoraLite® Plus 647 Rabbit IgG Isotype Control Recombinant Antibody (CL647-98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMIGD2/CD28H in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: Transfected HEK-293T cells

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98263 targets TMIGD2/CD28H in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2264

  Product name: Recombinant Human TMIGD2/CD28H protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-150 aa of BC015655

  Sequence: LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPG

• Full Name: transmembrane and immunoglobulin domain containing 2
• Calculated Molecular Weight: 282 aa, 31 kDa
• GenBank Accession Number: BC015655
• Gene Symbol: TMIGD2
• Gene ID (NCBI): 126259
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96BF3
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Transmembrane and immunoglobulin domain-containing protein 2 (TMIGD2, also known as CD28H and IGPR1), plays a role in cell-cell interaction, migration, and angiogenesis. Through interaction with HHLA2, it costimulates T-cells in the context of TCR-mediated activation and enhances T-cell proliferation and cytokine production via an AKT-dependent signaling cascade (PMID: 22419821; 23784006). TMIGD2 has been associated with several diseases, particularly in the context of cancer. It is aberrantly expressed by human AML cells and can be used to identify and enrich functional LSCs (PMID: 38167704).