TMLHE Polyclonal antibody

• 

  WB analysis of human liver using 16621-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16621-1-AP (TMLHE antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16621-1-AP

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 16621-1-AP (TMLHE antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 16621-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16621-1-AP (TMLHE antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 16621-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 16621-1-AP (TMLHE antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TMLHE Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16621-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

TMLD, TML-alpha-ketoglutarate dioxygenase, Epsilon-trimethyllysine hydroxylase, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase, EC:1.14.11.8

---

Tested Applications

• Positive WB detected in: human liver tissue, rat kidney tissue, Jurkat cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below

Product Information

16621-1-AP targets TMLHE in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rabbit
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9919

  Product name: Recombinant human TMLHE protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-376 aa of BC025269

  Sequence: MWYHRLSHLHSRLQDLLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI

• Full Name: trimethyllysine hydroxylase, epsilon
• Calculated Molecular Weight: 376 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC025269
• Gene Symbol: TMLHE
• Gene ID (NCBI): 55217
• RRID: AB_2205303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NVH6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Trimethyllysine dioxygenase (TMLHE) encodes the first enzyme in carnitine biosynthesis, N6-trimethyllysine dioxygenase (TMLD) and enzyme deficiency was suggested to be a risk factor for ASD.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Discov; Identification of BBOX1 as a Therapeutic Target in Triple-Negative Breast Cancer.; Authors - Chengheng Liao ; KD Validated
mouse	WB	Cell Rep; Inborn Errors of Long-Chain Fatty Acid β-Oxidation Link Neural Stem Cell Self-Renewal to Autism.; Authors - Zhigang Xie ; KD Validated
human	WB	Cell Chem Biol; Controlled lipid β-oxidation and carnitine biosynthesis by a vitamin D metabolite.; Authors - Aileen Mendoza
human,rabbit	WB	bioRxiv; αKG-mediated carnitine synthesis promotes homologous recombination via histone acetylation; Authors - Apoorva Uboveja
Human	WB	Nat Commun; BBOX1 restrains TBK1-mTORC1 oncogenic signaling in clear cell renal cell carcinoma; Authors - Chengheng Liao