• Featured Product
  • KD/KO Validated

TMLHE Polyclonal antibody

TMLHE Polyclonal Antibody for WB, IHC, ELISA
Cat No. 16621-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, ELISA

TMLD, TML-alpha-ketoglutarate dioxygenase, Epsilon-trimethyllysine hydroxylase, Epsilon-trimethyllysine 2-oxoglutarate dioxygenase, EC:1.14.11.8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman liver tissue, rat kidney tissue, Jurkat cells
Positive IHC detected inhuman stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16621-1-AP targets TMLHE in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rabbit
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9919

Product name: Recombinant human TMLHE protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-376 aa of BC025269

Sequence: MWYHRLSHLHSRLQDLLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI

Predict reactive species
Full Name trimethyllysine hydroxylase, epsilon
Calculated Molecular Weight 376 aa, 44 kDa
Observed Molecular Weight 44 kDa
GenBank Accession NumberBC025269
Gene Symbol TMLHE
Gene ID (NCBI) 55217
RRIDAB_2205303
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NVH6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Trimethyllysine dioxygenase (TMLHE) encodes the first enzyme in carnitine biosynthesis, N6-trimethyllysine dioxygenase (TMLD) and enzyme deficiency was suggested to be a risk factor for ASD.

Protocols

Product Specific Protocols
IHC protocol for TMLHE antibody 16621-1-APDownload protocol
WB protocol for TMLHE antibody 16621-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cancer Discov

Identification of BBOX1 as a Therapeutic Target in Triple-Negative Breast Cancer.

Authors - Chengheng Liao
  • KD Validated
mouseWB

Cell Rep

Inborn Errors of Long-Chain Fatty Acid β-Oxidation Link Neural Stem Cell Self-Renewal to Autism.

Authors - Zhigang Xie
  • KD Validated
humanWB

Cell Chem Biol

Controlled lipid β-oxidation and carnitine biosynthesis by a vitamin D metabolite.

Authors - Aileen Mendoza
human,rabbitWB

bioRxiv

αKG-mediated carnitine synthesis promotes homologous recombination via histone acetylation

Authors - Apoorva Uboveja
HumanWB

Nat Commun

BBOX1 restrains TBK1-mTORC1 oncogenic signaling in clear cell renal cell carcinoma

Authors - Chengheng Liao
Loading...
||
New chat Able
正在加载,请稍候...