Use Able AI chat for product recommendations

TMUB1 Polyclonal antibody, PBS Only

TMUB1 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 16638-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

16638-1-PBS targets TMUB1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9988

Product name: Recombinant human TMUB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-246 aa of BC000936

Sequence: MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATDSMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAWPHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP

Predict reactive species
Full Name transmembrane and ubiquitin-like domain containing 1
Calculated Molecular Weight 26 kDa
Observed Molecular Weight27 kDa, 24 kDa
GenBank Accession NumberBC000936
Gene Symbol TMUB1
Gene ID (NCBI) 83590
RRIDAB_3085503
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BVT8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Transmembrane and ubiquitin-like domain-containing protein 1 (TMUB1), also referred to as hepatocyte odd protein shuttling (HOPS), is a transmembrane ubiquitin-like protein that was originally identified in the regenerated liver. HOPS is a transmembrane protein released into the cell by an enzymatic cleavage. This allows HOPS to be shuttled from the nucleus to the cytoplasm and vice versa, depending on cell cycle and environmental stress conditions. HOPS cDNA expression gives rise to the translation of three different proteins with distinct molecular weights of 27, 24 and 21 kDa, respectively.The three isoforms of HOPS are differentially expressed depending on the tissue being examined. In the brain, the shortest isoform prevails over the other, whereas in the intestine the higher molecular weight isoform prevails among the other two. Indeed, HOPS shows a different concentration of the three isoforms, which can play different cell-dependent functions. The ratio between different isoforms may vary owing to physiopathological changes in the cell (PMID:32860479).16638-1-AP can detect two bands and some literature also detected two bands (PMID:30610893, 29777440, 29967478)

Loading...
||
New chat

Able

正在加载,请稍候...