TMX2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMX2 Polyclonal antibody (19838-1-AP)

• Featured Product
• KD/KO Validated

TMX2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 19838-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

CGI 31, My009, PDIA12, PIG26, PSEC0045, TMX2, TXNDC14, UNQ237/PRO270

• 

  WB analysis using 19838-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19838-1-AP (TMX2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 19838-1-AP

  WB result of TMX2 antibody (19838-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TMX2 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 19838-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 19838-1-AP (TMX2 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 19838-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 19838-1-AP (TMX2 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 19838-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 19838-1-AP (TMX2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 19838-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 19838-1-AP (TMX2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: human placenta tissue, HeLa cells, mouse placenta tissue, mouse testis tissue, rat tissue
• Positive IHC detected in: human kidney tissue, human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19838-1-AP targets TMX2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13828

  Product name: Recombinant human TMX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 130-296 aa of BC000666

  Sequence: PLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK

• Full Name: thioredoxin-related transmembrane protein 2
• Calculated Molecular Weight: 296 aa, 34 kDa
• Observed Molecular Weight: 30 kDa, 34 kDa
• GenBank Accession Number: BC000666
• Gene Symbol: TMX2
• Gene ID (NCBI): 51075
• RRID: AB_10642435
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y320
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thioredoxin-related transmembrane proteins (TMXs) are protein disulfide isomerase (PDI) family members and possess a transmembrane region. TMX2 cDNA was first isolated in 2003, and TMX2 mRNA has been found in a variety of human tissues, with the highest levels in the heart, brain, liver, kidney, and pancreas.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Autophagy; TMX2 potentiates cell viability of hepatocellular carcinoma by promoting autophagy and mitophagy.; Authors - Weiyu Zhang ; KD Validated
human	WB,IF	Cell Rep; The ER thioredoxin-related transmembrane protein TMX2 controls redox-mediated tethering of ER-mitochondria contacts.; Authors - Junsheng Chen ; KO Validated