Mouse TNC/Tenascin-C Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse colon using 85821-1-RR (same clone as 85821-1-PBS)

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 85821-1-RR (Tnc antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85821-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 85821-1-RR (same clone as 85821-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 85821-1-RR (Tnc antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85821-1-PBS in a different storage buffer formulation.

TNC/Tenascin-C Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85821-1-PBS

Clone No.242866C6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Indirect ELISA

Synonyms

Hexabrachion, Hxb, Tenascin, Tenascin-C, TN

---

Product Information

85821-1-PBS targets TNC/Tenascin-C in WB, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2849

  Product name: Recombinant Mouse Tnc protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1884-2099 aa of N/A

  Sequence: GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

• Full Name: tenascin C
• Calculated Molecular Weight: 232 kDa
• Observed Molecular Weight: 210-230 kDa
• GenBank Accession Number: N/A
• Gene Symbol: Tnc
• Gene ID (NCBI): 21923
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q80YX1-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation.