TNC/Tenascin-C Recombinant monoclonal antibody

• 

  WB analysis of mouse colon using 85821-1-RR

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 85821-1-RR (Tnc antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 85821-1-RR

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 85821-1-RR (Tnc antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

TNC/Tenascin-C Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85821-1-RR

Clone No.242866C6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

Hexabrachion, Hxb, Tenascin, Tenascin-C, TN

---

Tested Applications

• Positive WB detected in: mouse colon tissue, mouse thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85821-1-RR targets TNC/Tenascin-C in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2849

  Product name: Recombinant Mouse Tnc protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 1884-2099 aa of N/A

  Sequence: GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

• Full Name: tenascin C
• Calculated Molecular Weight: 232 kDa
• Observed Molecular Weight: 210-230 kDa
• GenBank Accession Number: N/A
• Gene Symbol: Tnc
• Gene ID (NCBI): 21923
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q80YX1-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation.