TNFAIP1 Monoclonal antibody

• 

  WB analysis of HUVEC using 60327-1-Ig

  HUVEC, HEK-293 and HeLa cells were subjected to SDS PAGE followed by western blot with 60327-1-Ig (TNFAIP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 60327-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 60327-1-Ig (TNFAIP1 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 60327-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60327-1-Ig (TNFAIP1 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 60327-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60327-1-Ig (TNFAIP1 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 60327-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60327-1-Ig (TNFAIP1 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 60327-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60327-1-Ig (TNFAIP1 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TNFAIP1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 60327-1-Ig

Clone No.4F11B5

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

4F11B5, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2, BTB/POZ domain-containing protein TNFAIP1, EDP1, Tumor necrosis factor, alpha-induced protein 1, endothelial

---

Tested Applications

• Positive WB detected in: HUVEC cells, HeLa cells
• Positive IHC detected in: human lung cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

60327-1-Ig targets TNFAIP1 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7873

  Product name: Recombinant human TNFAIP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 71-239 aa of BC001949

  Sequence: ILIDRCGKHFGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDHLLKNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKLAEVCCTSIVYATEKKQTKV

• Full Name: tumor necrosis factor, alpha-induced protein 1 (endothelial)
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC001949
• Gene Symbol: TNFAIP1
• Gene ID (NCBI): 7126
• RRID: AB_2881437
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13829
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Oncotarget; PMID: 29137317; Authors - Wu Shuang