TNFAIP1 Monoclonal antibody, PBS Only

• 

  WB analysis of HUVEC using 60327-1-Ig (same clone as 60327-1-PBS)

  HUVEC, HEK-293 and HeLa cells were subjected to SDS PAGE followed by western blot with 60327-1-Ig (TNFAIP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60327-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60327-1-Ig (same clone as 60327-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 60327-1-Ig (TNFAIP1 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60327-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 60327-1-Ig (same clone as 60327-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60327-1-Ig (TNFAIP1 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60327-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 60327-1-Ig (same clone as 60327-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 60327-1-Ig (TNFAIP1 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60327-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60327-1-Ig (same clone as 60327-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60327-1-Ig (TNFAIP1 antibody) at dilution of 1:300 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60327-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 60327-1-Ig (same clone as 60327-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60327-1-Ig (TNFAIP1 antibody) at dilution of 1:300 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60327-1-PBS in a different storage buffer formulation.

TNFAIP1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 60327-1-PBS

Clone No.4F11B5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

4F11B5, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2, BTB/POZ domain-containing protein TNFAIP1, EDP1, Tumor necrosis factor, alpha-induced protein 1, endothelial

---

Product Information

60327-1-PBS targets TNFAIP1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7873

  Product name: Recombinant human TNFAIP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 71-239 aa of BC001949

  Sequence: ILIDRCGKHFGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQGLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERLIESSTKPVVKLLYNRSNNKYSYTSNSDDHLLKNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKLAEVCCTSIVYATEKKQTKV

• Full Name: tumor necrosis factor, alpha-induced protein 1 (endothelial)
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC001949
• Gene Symbol: TNFAIP1
• Gene ID (NCBI): 7126
• RRID: AB_2881437
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13829
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.