TNFAIP8L1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TNFAIP8L1 Polyclonal antibody, PBS Only (17366-1-PBS)

• 

  IP experiment of mouse brain using 17366-1-AP (same clone as 17366-1-PBS)

  IP result of anti-TNFAIP8L1 (IP:17366-1-AP, 4ug; Detection:17366-1-AP 1:500) with mouse brain tissue lysate 1720 ug. This data was developed using the same antibody clone with 17366-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17366-1-AP (same clone as 17366-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17366-1-AP (TNFAIP8L1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17366-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17366-1-AP (same clone as 17366-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17366-1-AP (TNFAIP8L1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17366-1-PBS in a different storage buffer formulation.

TNFAIP8L1 Polyclonal Antibody for IHC, IP, Indirect ELISA

Cat No. 17366-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IP, Indirect ELISA

Synonyms

Oxidative stress-regulated gene-beta, Oxy-beta, TIPE1, TNF alpha-induced protein 8-like protein 1, TNFAIP8-like protein 1

---

Product Information

17366-1-PBS targets TNFAIP8L1 in IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10778

  Product name: Recombinant human TNFAIP8L1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-186 aa of BC017672

  Sequence: MDTFSTKSLALQAQKKLLSKMASKAVVAVLVDDTSSEVLDELYRATREFTRSRKEAQKMLKNLVKVALKLGLLLRGDQLGGEELALLRRFRHRARCLAMTAVSFHQVDFTFDRRVLAVGLLECRDLLHQAVGPHLTAKSHGRINHVFGHLADCDFLAALYGPAEPYRSHLRRICEGLGRMLDEGSL

• Full Name: tumor necrosis factor, alpha-induced protein 8-like 1
• Calculated Molecular Weight: 186 aa, 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC017672
• Gene Symbol: TNFAIP8L1
• Gene ID (NCBI): 126282
• RRID: AB_3741918
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WVP5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNFAIP8L1, also known as TIPE1, is a member of the TNFAIP8 family. TNFAIP8L1 possesses anti-apoptotic and pro-tumorigenic properties, which are crucial for tumor initiation and progression as well as the immune system's ability to combat cancer. TNFAIP8L1 is highly expressed in most cancer cell lines, particularly in cells transformed by viral genomes. The calculated molecular weight of TNFAIP8L1 is 21 kDa. (PMID: 36254562, PMID: 38065896, PMID: 21600655)