TIPE2/TNFAIP8L2 Recombinant monoclonal antibody, PBS Only

TIPE2/TNFAIP8L2 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 85759-4-PBS
Clone No.250047D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

TIPE2, Inflammation factor protein 20, TNF alpha-induced protein 8-like protein 2, TNFAIP8 like protein 2, TNFAIP8L2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85759-4-PBS targets TIPE2/TNFAIP8L2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7964

Product name: Recombinant human TNFAIP8L2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-184 aa of BC063014

Sequence: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL

Predict reactive species
Full Name tumor necrosis factor, alpha-induced protein 8-like 2
Calculated Molecular Weight 184 aa, 21 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC063014
Gene Symbol TIPE2
Gene ID (NCBI) 79626
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6P589
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TIPE2 (TNF-α-inducible protein 8-like 2, or TNFAIP8L2), a negative immune regulator, is essential for maintaining immune homeostasis. TIPE2 shares considerable sequence homology with members of the tumor necrosis factor-α-inducible protein 8 (TNFAIP8) family, which are thought to regulate cellular and immune homeostasis. TIPE2 acts as a negative regulator of Toll-like receptor and T-cell receptor function and is preferentially expressed in lymphoid tissues. TIPE2 plays an essential role in a signal transduction pathway that links the inflammatory immune response to specific conditions after cerebral ischemia

Loading...
||
New chat Able
正在加载,请稍候...