TIPE2/TNFAIP8L2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85759-4-RR (same clone as 85759-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85759-4-RR (TIPE2/TNFAIP8L2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85759-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85759-4-RR (same clone as 85759-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85759-4-RR (TIPE2/TNFAIP8L2 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85759-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85759-4-RR (same clone as 85759-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85759-4-RR (TNFAIP8L2 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85759-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85759-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85759-4-RR against Human TNFAIP8L2 were performed. The affinity constant is below 1 pM.

TIPE2/TNFAIP8L2 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85759-4-PBS

Clone No.250047D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

TIPE2, Inflammation factor protein 20, TNF alpha-induced protein 8-like protein 2, TNFAIP8 like protein 2, TNFAIP8L2

---

Product Information

85759-4-PBS targets TIPE2/TNFAIP8L2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7964

  Product name: Recombinant human TNFAIP8L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-184 aa of BC063014

  Sequence: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL

• Full Name: tumor necrosis factor, alpha-induced protein 8-like 2
• Calculated Molecular Weight: 184 aa, 21 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC063014
• Gene Symbol: TIPE2
• Gene ID (NCBI): 79626
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q6P589
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TIPE2 (TNF-α-inducible protein 8-like 2, or TNFAIP8L2), a negative immune regulator, is essential for maintaining immune homeostasis. TIPE2 shares considerable sequence homology with members of the tumor necrosis factor-α-inducible protein 8 (TNFAIP8) family, which are thought to regulate cellular and immune homeostasis. TIPE2 acts as a negative regulator of Toll-like receptor and T-cell receptor function and is preferentially expressed in lymphoid tissues. TIPE2 plays an essential role in a signal transduction pathway that links the inflammatory immune response to specific conditions after cerebral ischemia