TIPE2/TNFAIP8L2 Recombinant monoclonal antibody

TIPE2/TNFAIP8L2 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 85759-4-RR
Clone No.250047D9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

TIPE2, Inflammation factor protein 20, TNF alpha-induced protein 8-like protein 2, TNFAIP8 like protein 2, TNFAIP8L2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, HL-60 cells, RAW 264.7 cells, mouse spleen tissue, rat spleen tissue
Positive IHC detected inmouse spleen tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85759-4-RR targets TIPE2/TNFAIP8L2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7964

Product name: Recombinant human TNFAIP8L2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-184 aa of BC063014

Sequence: MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVIKDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLLTECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLDEGKL

Predict reactive species
Full Name tumor necrosis factor, alpha-induced protein 8-like 2
Calculated Molecular Weight 184 aa, 21 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC063014
Gene Symbol TIPE2
Gene ID (NCBI) 79626
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6P589
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIPE2 (TNF-α-inducible protein 8-like 2, or TNFAIP8L2), a negative immune regulator, is essential for maintaining immune homeostasis. TIPE2 shares considerable sequence homology with members of the tumor necrosis factor-α-inducible protein 8 (TNFAIP8) family, which are thought to regulate cellular and immune homeostasis. TIPE2 acts as a negative regulator of Toll-like receptor and T-cell receptor function and is preferentially expressed in lymphoid tissues. TIPE2 plays an essential role in a signal transduction pathway that links the inflammatory immune response to specific conditions after cerebral ischemia

Protocols

Product Specific Protocols
IHC protocol for TIPE2/TNFAIP8L2 antibody 85759-4-RRDownload protocol
WB protocol for TIPE2/TNFAIP8L2 antibody 85759-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...