PE Anti-Mouse TNFRSF13B/CD267 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• PE Anti-Mouse TNFRSF13B/CD267 Rabbit Recombinant Antibody (PE-98439-2)

TNFRSF13B/CD267 Uni-rAb^® Recombinant Antibody for FC

Cat No. PE-98439-2 Copied!

Clone No. 250265B1

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

CD267, Taci, Tnfrsf13b, Transmembrane activator and CAML interactor, Tumor necrosis factor receptor superfamily member 13B

• 

  FC experiment of mouse splenocytes using PE-98439-2

  1x10^6 mouse splenocytes were surface stained with CoraLite® Plus 647 Anti-Mouse CD19, and 0.1 ug PE Anti-Mouse TNFRSF13B/CD267 Rabbit RecAb (PE-98439-2, Clone: 250265B1) or PE Rabbit IgG Isotype Control Recombinant Antibody (PE-98136, Clone: 240953C9). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using PE-98439-2

  1x10^6 mouse splenocytes were surface stained with 0.1 ug PE Anti-Mouse TNFRSF13B/CD267 Rabbit RecAb (PE-98439-2, Clone: 250265B1) (red) or PE Rabbit IgG Isotype Control Recombinant Antibody (PE-98136, Clone: 240953C9) (blue). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TNFRSF13B/CD267 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

PE-98439-2 targets TNFRSF13B/CD267 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1814

  Product name: Recombinant Mouse TNFRSF13B/CD267 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 5-128 aa of NM_021349.1

  Sequence: FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYC

• Full Name: tumor necrosis factor receptor superfamily, member 13b
• Calculated Molecular Weight: 27 kDa
• GenBank Accession Number: NM_021349.1
• Gene Symbol: Tnfrsf13b
• Gene ID (NCBI): 57916
• Conjugate: PE Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 496 nm, 565 nm / 578 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ET35
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Tumor necrosis factor receptor superfamily member 13B (TNFRSF13B), also known as CD267 or TACI, is a transmembrane protein of the TNF receptor superfamily found predominantly on B cells (PMID: 10920230). TACI is also expressed on activated T cells, myeloma cells, and expressed by monocytes intracellularly at a low level (PMID: 11429548; 16825497). TNFRSF13B is a receptor for TNFSF13/APRIL/CD256 and TNFSF13B/BAFF/CD257 and mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-κB and AP-1 (PMID: 10956646; 10973284; 9311921). It is involved in the stimulation of B- and T-cell function and the regulation of humoral immunity.