FcZero-rAb® APC Anti-Mouse TNFRSF9/CD137 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FcZero-rAb® APC Anti-Mouse TNFRSF9/CD137 Rabbit Recombinant Antibody (APC-FcA98182)

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

TNFRSF9/CD137 FcZero-rAb^® Recombinant Antibody for FC

Cat No. APC-FcA98182 Copied!

Clone No. 241647E11

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

4-1BB, 4-1BB ligand receptor, CD137, Ila, Ly63

• 

  FC experiment of mouse splenocytes using APC-FcA98182

  1x10^6 untreated or Con A treated mouse splenocytes were surface stained with FcZero-rAb® CoraLite® Plus 405 Anti-Mouse CD25/IL-2RA Rabbit Recombinant Antibody (CL405-FcA98288, Clone: 242494H5) and 0.1 ug APC Anti-Mouse TNFRSF9/CD137 Rabbit RecAb (APC-FcA98182, Clone: 241647E11). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of mouse splenocytes using APC-FcA98182

  1x10^6 Con A treated mouse splenocytes were surface stained with 0.1 ug APC Anti-Mouse TNFRSF9/CD137 Rabbit RecAb (APC-FcA98182, Clone: 241647E11) (red) or FcZero-rAb® APC Rabbit IgG Isotype Control Recombinant Antibody (APC-FcA98136, Clone: 240953C9) (blue). 1x10^6 untreated mouse splenocytes were surface stained with 0.1 ug APC Anti-Mouse TNFRSF9/CD137 Rabbit RecAb (APC-FcA98182, Clone: 241647E11) (black, dashed). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TNFRSF9/CD137 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: Con A treated mouse splenocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98182 targets TNFRSF9/CD137 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1627

  Product name: Recombinant Mouse TNFRSF9/CD137 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 24-187 aa of NM_001077509.1

  Sequence: VQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

• Full Name: tumor necrosis factor receptor superfamily, member 9
• Calculated Molecular Weight: 28 kDa
• GenBank Accession Number: NM_001077509.1
• Gene Symbol: Tnfrsf9
• Gene ID (NCBI): 21942
• RRID: AB_3746582
• Conjugate: APC Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 650 nm / 660 nm
• Excitation Laser: Red Laser (633 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P20334
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD137, also known as TNFRSF9 or 4-1BB, is an inducible T cell surface receptor that belongs to the tumor necrosis factor receptor superfamily. CD137 is a transmembrane protein expressed on the surface of activated T-cells. In addition, activation-dependent expression of CD137 has also been found in B lymphocytes, monocytes, and diverse nonlymphoid cell types. CD137 provides a co-stimulatory signal that enhances the survival, and differentiation of cells, and has a crucial role in the development of CD8 cytotoxic T cells and anti-tumor immunity. (PMID: 9826581; 23696891)