TNFSF15 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TNFSF15 Recombinant monoclonal antibody (87367-3-RR)

• 

  WB analysis using 87367-3-RR

  Transfected HEK-293T cell lysates were subjected to SDS PAGE followed by western blot with 87367-3-RR (TNFSF15 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with Beta Actin Monoclonal antibody (66009-1-Ig) as loading control.

• 

  IF Staining of Transfected HEK-293 using 87367-3-RR

  Immunofluorescent analysis of (4% PFA) fixed Transfected HEK-293 cells using TNFSF15 antibody (87367-3-RR, Clone: 250983F1 ) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• 

  Affinity of 87367-3-RR

  Biolayer interferometry (BLl) kinetic assays of 87367-3-RR against Mouse TNFSF15 were performed. The affinity constant is below 1 pM.

TNFSF15 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87367-3-RR

Clone No.250983F1

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IF/ICC, ELISA

Synonyms

Tl1, Tl1, Vegi, TNF15, TNFSF 15, Vegi

---

Tested Applications

• Positive WB detected in: Mouse TNFSF15 Transfected HEK-293T cells
• Positive IF/ICC detected in: Transfected HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87367-3-RR targets TNFSF15 in WB, IF/ICC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5273

  Product name: Recombinant Mouse TNFSF15 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 61-252 aa of /

  Sequence: AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

• Full Name: tumor necrosis factor (ligand) superfamily, member 15
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: /
• Gene Symbol: Tnfsf15
• Gene ID (NCBI): 326623
• RRID: AB_3745488
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5UBV8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.