TNIK Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84231-4-RR (same clone as 84231-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84231-4-RR (TNIK antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84231-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 84231-4-RR (same clone as 84231-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84231-4-RR (TNIK antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84231-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 84231-4-RR (same clone as 84231-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 84231-4-RR (TNIK antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84231-4-PBS in a different storage buffer formulation.

• 

  IF Staining of K-562 using 84231-4-RR (same clone as 84231-4-PBS)

  Immunofluorescent analysis of (4% PFA) fixed K-562 cells using TNIK antibody (84231-4-RR, Clone: 241518D9 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84231-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84231-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84231-4-RR against Human TNIK were performed. The affinity constant is 2.01 nM.

TNIK Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84231-4-PBS

Clone No.241518D9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

241518D9, EC:2.7.11.1, KIAA0551, TRAF2 and NCK-interacting protein kinase

---

Product Information

84231-4-PBS targets TNIK in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34132

  Product name: Recombinant human TNIK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 585-636 aa of BC150256

  Sequence: LRPVDPQIPHLVAVKSQGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMP

• Full Name: TRAF2 and NCK interacting kinase
• Observed Molecular Weight: 155~180 kDa
• GenBank Accession Number: BC150256
• Gene Symbol: TNIK
• Gene ID (NCBI): 23043
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9UKE5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNIK (Traf2- and Nck-interacting kinase) is one of the germinal center kinase family members involved in cytoskeleton organization and neuronal dendrite extension, which had been implicated in postsynaptic signaling as well as in regulation of cell proliferation. TNiK is expressed in the nervous system and plays key roles at the synapse and nucleus, In non-neuronal cells, TNiK has been described as a critical component of transcriptional regulatory mechanisms, mediated by Wnt signaling (PMID: 24566388). TNIK is also an essential regulatory component of the T-cell factor-4 and β-catenin transcriptional complex and is required for the tumor-initiating function of colorectal cancer stem cells (PMID: 10521462). Western blot analysis detected TNIK at an apparent molecular mass of 150~180 kDa as cited in literature (PMID: 24566388).