TNNC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TNNC1 Polyclonal antibody, PBS Only (13504-1-PBS)

• 

  WB analysis of mouse skeletal muscle using 13504-1-AP (same clone as 13504-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 13504-1-AP (TNNC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13504-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human stomach using 13504-1-AP (same clone as 13504-1-PBS)

  human stomach tissue were subjected to SDS PAGE followed by western blot with 13504-1-AP (TNNC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13504-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse heart using 13504-1-AP (same clone as 13504-1-PBS)

  IP result of anti-TNNC1 (IP:13504-1-AP, 4ug; Detection:13504-1-AP 1:600) with mouse heart tissue lysate 4400ug. This data was developed using the same antibody clone with 13504-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 13504-1-AP (same clone as 13504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 13504-1-AP (TNNC1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 13504-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 13504-1-AP (same clone as 13504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 13504-1-AP (TNNC1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 13504-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 13504-1-AP (same clone as 13504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 13504-1-AP (TNNC1 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13504-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 13504-1-AP (same clone as 13504-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 13504-1-AP (TNNC1 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13504-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 13504-1-AP (same clone as 13504-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using TNNC1 antibody (13504-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13504-1-PBS in a different storage buffer formulation.

• 

  FC experiment of U2OS using 13504-1-AP (same clone as 13504-1-PBS)

  1x10^6 U2OS cells were intracellularly stained with 0.4 ug TNNC1 Polyclonal antibody (13504-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 13504-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TNNC1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 13504-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

TN C, TNC, TN-C, TNNC, Troponin C

---

Product Information

13504-1-PBS targets TNNC1 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4339

  Product name: Recombinant human TNNC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-161 aa of BC030244

  Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

• Full Name: troponin C type 1 (slow)
• Calculated Molecular Weight: 161 aa, 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC030244
• Gene Symbol: TNNC1
• Gene ID (NCBI): 7134
• RRID: AB_2256271
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63316
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. TnC plays an important role in excitation-contraction coupling and is the primary target of compounds such as levosimendan that augment Ca2+ responsiveness of the thin filament.