Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue, human stomach tissue |
| Positive IP detected in | mouse heart tissue |
| Positive IHC detected in | human skeletal muscle tissue, mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells |
| Positive FC (Intra) detected in | U2OS cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13504-1-AP targets TNNC1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4339 Product name: Recombinant human TNNC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-161 aa of BC030244 Sequence: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE Predict reactive species |
| Full Name | troponin C type 1 (slow) |
| Calculated Molecular Weight | 161 aa, 18 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC030244 |
| Gene Symbol | TNNC1 |
| Gene ID (NCBI) | 7134 |
| RRID | AB_2256271 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P63316 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Troponin is a central regulatory protein of striated muscle contraction, and together with tropomyosin, is located on the actin filament. Troponin consists of 3 subunits: TnI, which is the inhibitor of actomyosin ATPase; TnT, which contains the binding site for tropomyosin; and TnC, the protein encoded by this gene. TnC plays an important role in excitation-contraction coupling and is the primary target of compounds such as levosimendan that augment Ca2+ responsiveness of the thin filament.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TNNC1 antibody 13504-1-AP | Download protocol |
| IF protocol for TNNC1 antibody 13504-1-AP | Download protocol |
| IHC protocol for TNNC1 antibody 13504-1-AP | Download protocol |
| IP protocol for TNNC1 antibody 13504-1-AP | Download protocol |
| WB protocol for TNNC1 antibody 13504-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-TNNC1 antibody (Cat# 13504-1-AP) has 10 total citations published in journals including Nature Communications, J Cachexia Sarcopenia Muscle, Int J Mol Sci, J Proteome Res, Front Cardiovasc Med, Mol Cell Biol, Med Sci Monit, Onco Targets Ther, and Int Dent J. Research fields span cancer biology (ovarian, lung, oral, and hepatocellular carcinoma), cardiovascular disease (heart failure, cardiomyocyte lipotoxicity), muscle physiology, and proteomics. Applications include WB, IHC, and IF across human, rat, and mouse species.
| Species | Application | Title |
|---|---|---|
Nat Commun Calcium-dependent FAK/CREB/TNNC1 signalling mediates the effect of stromal MFAP5 on ovarian cancer metastatic potential.
| ||
J Cachexia Sarcopenia Muscle MyoMed205 Counteracts Titin Hyperphosphorylation and the Expression of Contraction-Regulating Proteins in a Rat Model of HFpEF | ||
Int J Mol Sci Skeletal Muscle Alterations in Different Phenotypes of Heart Failure with Preserved Ejection Fraction | ||
Int J Mol Sci Modulation of Titin and Contraction-Regulating Proteins in a Rat Model of Heart Failure with Preserved Ejection Fraction: Limb vs. Diaphragmatic Muscle | ||
Int Dent J Screening Differentially Expressed Proteins in Areca Nut-Related Oral Squamous Cell Carcinoma Using Tandem Mass Tag Proteomics | ||
J Proteome Res iTRAQ-based proteomic analysis reveals recovery of impaired mitochondrial function in ischemic myocardium by Shenmai formula. |
