CoraLite® Plus 488-conjugated TOB1 Recombinant monoclonal antibody

TOB1 Recombinant Antibody for IF/ICC
Cat No. CL488-83944-2
Clone No.241043A9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Transducer of erbB 2 1, TOB, Protein Tob1, PIG49, APRO6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83944-2 targets TOB1 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6714

Product name: Recombinant human TOB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-345 aa of BC031406

Sequence: MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN

Predict reactive species
Full Name transducer of ERBB2, 1
Calculated Molecular Weight 38 kDa
GenBank Accession NumberBC031406
Gene Symbol TOB1
Gene ID (NCBI) 10140
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP50616
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TOB1, also known as APRO6 or TROB1, is a member of the transducer of erbB-2/B-cell translocation gene protein family. Members of this family are anti-proliferative factors that have the potential to regulate cell growth. The TOB1 protein has a large additional C-terminal region, which contains PAM2 motifs that mediate interactions with poly(A)-binding proteins. It is mainly located in the cell nucleus and will transfer between the cell nucleus and the cytoplasm. The more phosphorylation, the more obvious the cytoplasmic localization.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TOB1 antibody CL488-83944-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...