TOE1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67829-1-Ig (same clone as 67829-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67829-1-Ig (TOE1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67829-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67829-1-Ig (same clone as 67829-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67829-1-Ig (TOE1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67829-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67829-1-Ig (same clone as 67829-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67829-1-Ig (TOE1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67829-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67829-1-Ig (same clone as 67829-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67829-1-Ig (TOE1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67829-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67829-1-Ig (same clone as 67829-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67829-1-Ig (TOE1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67829-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67829-1-Ig (same clone as 67829-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TOE1 antibody (67829-1-Ig, Clone: 2C10H7 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67829-1-PBS in a different storage buffer formulation.

TOE1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67829-1-PBS

Clone No.2C10H7

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FLJ13949, Target of EGR1 protein 1, TOE1

---

Product Information

67829-1-PBS targets TOE1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28982

  Product name: Recombinant human TOE1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-262 aa of BC009364

  Sequence: MAADSDDGAVSAPAASDGGVSKSTTSGEELVVQVPVVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERYKAVCHAARTRSILSLGLACFKRQPDKGEHSYLAQVFNLTLLCMEEYVIEPKSVQFLIQHGFNFNQQYAQGIPYHKGNDKGDESQSQSVRTLFLELIRARRPLVLHNGLIDLVFLYQNFYAHLPESLGTFTADLCEMFPAGIYDTKYAAEFHARFVASYLEYAFRKCERENGKQRAAG

• Full Name: target of EGR1, member 1 (nuclear)
• Calculated Molecular Weight: 510 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC009364
• Gene Symbol: TOE1
• Gene ID (NCBI): 114034
• RRID: AB_2918591
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96GM8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TOE1, also known as hCaf1z, belongs to the DEDD family of deadenylases. TOE1 was initially identified as a direct target gene of ERG1, an immediate early transcription factor. TOE1 encodes an Asp-Glu-Asp-Asp deadenylase that specifically localizes to Cajal bodies in the nucleus, where assembly and maturation of small nuclear ribonucleoprotein particles, and telomerase ribonucleoprotein complex take place (PMID: 36257135). TOE1 has 2 isoforms with the molecular mass of 48 and 57 kDa.