TOM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TOM1 Polyclonal antibody (17506-1-AP)

TOM1 Polyclonal Antibody for WB, ELISA

Cat No. 17506-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

IMD85, Target of Myb protein 1, Target of Myb1 membrane trafficking protein

• 

  WB analysis of human liver using 17506-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 17506-1-AP (TOM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human skeletal muscle using 17506-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17506-1-AP (TOM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 17506-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 17506-1-AP (TOM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 17506-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 17506-1-AP (TOM1 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 17506-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17506-1-AP (TOM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TOM1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human liver tissue, HeLa cells, human skeletal muscle tissue, K-562 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17506-1-AP targets TOM1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11706

  Product name: Recombinant human TOM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-493 aa of BC046151

  Sequence: IYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEGKFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL

• Full Name: target of myb1 (chicken)
• Calculated Molecular Weight: 493 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC046151
• Gene Symbol: TOM1
• Gene ID (NCBI): 10043
• RRID: AB_2207412
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60784
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TOM1 is a member of VHS (VPS-27, Hrs, and STAM)-domain-containing protein family that functions as adaptor proteins in the intracellular trafficking and sorting of plasma membrane proteins. TOM1 colocalized with key proteins of the protein-degradation systems. Recently TOM1 has been reported to be localized in the hallmarks of AD pathology (27206884).

Publications

What published studies show

The TOM1 Polyclonal antibody (Cat# 17506-1-AP) has 1 total citation. It appears in Journal of Neurological Sciences (IF 3.1), published in 2016. The cited study investigated the immunolocalization of TOM1 in relation to protein degradation systems in Alzheimer's disease, using IHC and IF applications in human tissue. The research field is neurodegenerative disease, specifically Alzheimer's pathology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC,IF	J Neurol Sci; Immunolocalization of Tom1 in relation to protein degradation systems in Alzheimer's disease.; Authors - Kouki Makioka