TOM1 Polyclonal antibody

• 

  WB analysis of human liver using 17506-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 17506-1-AP (TOM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 17506-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 17506-1-AP (TOM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 17506-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17506-1-AP (TOM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 17506-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 17506-1-AP (TOM1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

TOM1 Polyclonal Antibody for WB, ELISA

Cat No. 17506-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

Target of Myb protein 1, target of myb1 (chicken), TOM1

---

Tested Applications

• Positive WB detected in: human liver tissue, HeLa cells, human skeletal muscle tissue, K-562 cells, L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

17506-1-AP targets TOM1 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11706

  Product name: Recombinant human TOM1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-493 aa of BC046151

  Sequence: IYEDLRRKGLEFPMTDLDMLSPIHTPQRTVFNSETQSGQDSVGTDSSQQEDSGQHAAPLPAPPILSGDTPIAPTPEQIGKLRSELEMVSGNVRVMSEMLTELVPTQAEPADLELLQELNRTCRAMQQRVLELIPQIANEQLTEELLIVNDNLNNVFLRHERFERFRTGQTTKAPSEAEPAADLIDMGPDPAATGNLSSQLAGMNLGSSSVRAGLQSLEASGRLEDEFDMFALTRGSSLADQRKEVKYEAPQATDGLAGALDARQQSTGAIPVTQACLMEDIEQWLSTDVGNDAEEPKGVTSEGKFDKFLEERAKAADRLPNLSSPSAEGPPGPPSGPAPRKKTQEKDDDMLFAL

• Full Name: target of myb1 (chicken)
• Calculated Molecular Weight: 493 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC046151
• Gene Symbol: TOM1
• Gene ID (NCBI): 10043
• RRID: AB_2207412
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60784
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TOM1 is a member of VHS (VPS-27, Hrs, and STAM)-domain-containing protein family that functions as adaptor proteins in the intracellular trafficking and sorting of plasma membrane proteins. TOM1 colocalized with key proteins of the protein-degradation systems. Recently TOM1 has been reported to be localized in the hallmarks of AD pathology (27206884).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC,IF	J Neurol Sci; Immunolocalization of Tom1 in relation to protein degradation systems in Alzheimer's disease.; Authors - Kouki Makioka