TOM1L2 Polyclonal antibody

• 

  WB analysis using 32179-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32179-1-AP (TOM1L2 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 32179-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 32179-1-AP (TOM1L2 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 32179-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32179-1-AP (TOM1L2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse cerebellum using 32179-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 32179-1-AP (TOM1L2 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse cerebellum using 32179-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 32179-1-AP (TOM1L2 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 32179-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TOM1L2 antibody (32179-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

TOM1L2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 32179-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Target Of Myb1 Like 2 Membrane Trafficking Protein, Target of Myb-like protein 2, TOM1-like protein 2

---

Tested Applications

• Positive WB detected in: A431 cells, A-253 cells, BxPC-3 cells, HaCaT cells, LNCaP cells, U-251 cells, NIH/3T3 cells, rat brain tissue, mouse brain tissue
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32179-1-AP targets TOM1L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37612

  Product name: Recombinant human TOM1L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-457 aa of NM_001082968.1

  Sequence: LRYERFERYRSGRSVQNASNGVLNEVTEDNLIDLGPGSPAVVSPMVGNTAPPSSLSSQLAGLDLGTESVSGTLSSLQQCNPRDGFDMFAQTRGNSLAEQRKTVTYEDPQAVGGLASALDNRKQSSEGIPVAQPSVMDDIEVWLRTDLKGDDLEEGVTS

• Full Name: target of myb1-like 2 (chicken)
• Calculated Molecular Weight: 56 kDa，507aa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_001082968.1
• Gene Symbol: TOM1L2
• Gene ID (NCBI): 146691
• RRID: AB_3670215
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZVM7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Target of Myb-like protein 2 (TOM1L2) acts as a MYO6/Myosin VI adapter protein that targets myosin VI to endocytic structures (PMID: 23023224). It may play a role in recruiting clathrin to endosomes and regulating growth factor-induced mitogenic signaling (PMID: 16412388; 16479011). TOM1L2 also regulates membrane trafficking that is linked to immunity and cell proliferation (PMID: 20604899).