CoraLite® Plus 488-conjugated TOMM40 Recombinant monoclonal antibody

TOMM40 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-85773-4
Clone No.250010E12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

TOM40, C19orf1, D19S1177E, p38.5, PER EC1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85773-4 targets TOMM40 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13065

Product name: Recombinant human TOMM40 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-361 aa of BC017224

Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

Predict reactive species
Full Name translocase of outer mitochondrial membrane 40 homolog (yeast)
Calculated Molecular Weight 38 kDa
Observed Molecular Weight38 kDa
GenBank Accession NumberBC017224
Gene Symbol TOMM40
Gene ID (NCBI) 10452
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO96008
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The translocase of outer mitochondria membrane 40 (TOMM40, also known as TOM40), located in the center of the TOM complex, is a channel-forming subunit of translocase. It can facilitate the fluid movement of preproteins into the mitochondria by associating with TOMM20. TOMM40 plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria (PMID: 31206022). TOMM40 has been reported to be associated with late-onset neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 TOMM40 antibody CL488-85773-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...