TOX4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TOX4 Polyclonal antibody, PBS Only (27988-1-PBS)

• 

  WB analysis using 27988-1-AP (same clone as 27988-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27988-1-AP (TOX4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27988-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat bladder using 27988-1-AP (same clone as 27988-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat bladder tissue slide using 27988-1-AP (TOX4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27988-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat bladder using 27988-1-AP (same clone as 27988-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat bladder tissue slide using 27988-1-AP (TOX4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27988-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 27988-1-AP (same clone as 27988-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27988-1-AP (TOX4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27988-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 27988-1-AP (same clone as 27988-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27988-1-AP (TOX4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27988-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse bladder using 27988-1-AP (same clone as 27988-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 27988-1-AP (TOX4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27988-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse bladder using 27988-1-AP (same clone as 27988-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 27988-1-AP (TOX4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27988-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 27988-1-AP (same clone as 27988-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TOX4 antibody (27988-1-AP) at dilution of 1:600 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 27988-1-PBS in a different storage buffer formulation.

TOX4 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 27988-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

TOX 4, MIG7, LCP1, C14orf92

---

Product Information

27988-1-PBS targets TOX4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27638

  Product name: Recombinant human TOX4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-215 aa of BC013689

  Sequence: SLDSDPSLAVSDVVGHFDDLADPSSSQDGSFSAQYGVQTLDMPVGMTHGLMEQGGGLLSGGLTMDLDHSIGTQYSANPPVTIDVPMTDMTSGLMGHSQLTTIDQSELSSQLGLSLGGGTILPPAQSPEDRLSTTPSPTSSLHEDGVEDFRRQLPSQKTVVVEAGKKQKAPKKR

• Full Name: TOX high mobility group box family member 4
• Calculated Molecular Weight: 621 aa, 66 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC013689
• Gene Symbol: TOX4
• Gene ID (NCBI): 9878
• RRID: AB_3086019
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94842
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TOX (Thymocyte selection-associated HMG bOX) genes represent a novel gene family and encode a novel nuclear DNA binding protein belonging to a large superfamily of HMG (high mobility group)-box family. TOX proteins consist a small subfamily of proteins, including TOX1, TOX2, TOX3, and TOX4. The TOX subfamily members are highly conserved among vertebrates. TOX4 was recently found to be one of the subunits of the PP1C, which consists of three regulatory proteins, PNUTS, TOX4, and WDR82, and one of the PP1 phosphatases, PP1α, β, andγ25. Tox4 can modulate cell fate by reprogramming from a somatic state into a pluripotent and neuronal fate (PMID:31519808). Despite a predicted molecular mass of TOX4 protein of 66 kDa, the detection band of western blot analysis in many literatures is 100 kDa (PMID:37286708;35365735). This antibody was also detected at around 100 kda.