TP53RK Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TP53RK Polyclonal antibody, PBS Only (26818-1-PBS)

• 

  WB analysis of Jurkat using 26818-1-AP (same clone as 26818-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26818-1-AP (TP53RK Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26818-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 26818-1-AP (same clone as 26818-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26818-1-AP (TP53RK Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26818-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 26818-1-AP (same clone as 26818-1-PBS)

  IP result of anti-TP53RK (IP:26818-1-AP, 4ug; Detection:26818-1-AP 1:700) with Jurkat cells lysate 3200ug. This data was developed using the same antibody clone with 26818-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 26818-1-AP (same clone as 26818-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26818-1-AP (TP53RK antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26818-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 26818-1-AP (same clone as 26818-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26818-1-AP (TP53RK antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26818-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TP53RK Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 26818-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

26818-1-PBS targets TP53RK in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25326

  Product name: Recombinant human TP53RK protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 154-253 aa of BC009727

  Sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG

• Full Name: TP53 regulating kinase
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC009727
• Gene Symbol: TP53RK
• Gene ID (NCBI): 112858
• RRID: AB_2880647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96S44
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.