Product Information
26818-1-PBS targets TP53RK in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25326 Product name: Recombinant human TP53RK protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 154-253 aa of BC009727 Sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG Predict reactive species |
| Full Name | TP53 regulating kinase |
| Calculated Molecular Weight | 28 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC009727 |
| Gene Symbol | TP53RK |
| Gene ID (NCBI) | 112858 |
| RRID | AB_2880647 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96S44 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |









