• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated TPM4 Monoclonal antibody

TPM4 Monoclonal Antibody for WB
Cat No. CL488-67244
Clone No.2E12D12

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat, pig

Applications

WB

TM30p1, TPM4, tropomyosin 4, Tropomyosin alpha 4 chain

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat skeletal muscle tissue, mouse skeletal muscle tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67244 targets TPM4 in WB applications and shows reactivity with Human, mouse, rat, pig samples.

Tested Reactivity Human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6947

Product name: Recombinant human TPM4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-248 aa of BC037576

Sequence: MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI

Predict reactive species
Full Name tropomyosin 4
Calculated Molecular Weight 248 aa, 29 kDa
Observed Molecular Weight 32-35 kDa
GenBank Accession NumberBC037576
Gene Symbol TPM4
Gene ID (NCBI) 7171
ENSEMBL Gene IDENSG00000167460
RRIDAB_3084330
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP67936
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

TPM4 is a member of tropomyosins (TPMs), a multi-gene family of actin-binding proteins present in all eukaryotic cells. In muscle, TPMs are responsible for mediating contraction via regulation of the actin-myosin interaction. As to non-muscle cells, its proposed role is to stabilize the actin filaments by modulating the interaction with proteins that are responsible for the regulation of actin dynamics. The form of TPM4 in muscle has a higher molecular weight than the form found in non-muscle cells.

Protocols

Product Specific Protocols
WB protocol for CL Plus 488 TPM4 antibody CL488-67244Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...