TPRKB Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TPRKB Polyclonal antibody, PBS Only (12800-1-PBS)

• 

  WB analysis of human heart using 12800-1-AP (same clone as 12800-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 12800-1-AP (TPRKB antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12800-1-PBS in a different storage buffer formulation.

TPRKB Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12800-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

12800-1-PBS targets TPRKB in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3551

  Product name: Recombinant human TPRKB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-175 aa of BC029492

  Sequence: MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL

• Full Name: TP53RK binding protein
• Calculated Molecular Weight: 175 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC029492
• Gene Symbol: TPRKB
• Gene ID (NCBI): 51002
• RRID: AB_2256289
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3C4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TPRKB, also named as CGI 121, belongs to the CGI121/TPRKB family. It interacts with TP53RK/PRPK and is widely expressed in all tissues. This antibody is a rabbit polyclonal antibody raised against full length TPRKB of human origin.