TPRKB Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66402-1-Ig (same clone as 66402-1-PBS)

  Western blot analysis of TPRKB in various cell lines using Proteintech antibody 66402-1-Ig at a dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66402-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66402-1-Ig (same clone as 66402-1-PBS)

  Various cells were subjected to SDS PAGE followed by western blot with 66402-1-Ig (TPRKB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66402-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66402-1-Ig (same clone as 66402-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66402-1-Ig (TPRKB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66402-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 66402-1-Ig (same clone as 66402-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66402-1-Ig (TPRKB antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66402-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 66402-1-Ig (same clone as 66402-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using TPRKB antibody (66402-1-Ig, Clone: 2D5B9 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66402-1-PBS in a different storage buffer formulation.

TPRKB Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66402-1-PBS

Clone No.2D5B9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

2D5B9, CGI-121, EKC/KEOPS complex subunit TPRKB, My019, PRPK-binding protein

---

Product Information

66402-1-PBS targets TPRKB in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18770

  Product name: Recombinant human TPRKB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-175 aa of BC029492

  Sequence: MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL

• Full Name: TP53RK binding protein
• Calculated Molecular Weight: 175 aa, 20 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC029492
• Gene Symbol: TPRKB
• Gene ID (NCBI): 51002
• RRID: AB_2881776
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9Y3C4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TPRKB, also named as CGI 121, belongs to the CGI121/TPRKB family. It interacts with TP53RK/PRPK and is widely expressed in all tissues.