TPRKB Monoclonal antibody

• 

  WB analysis using 66402-1-Ig

  Various cells were subjected to SDS PAGE followed by western blot with 66402-1-Ig (TPRKB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 66402-1-Ig

  Western blot analysis of TPRKB in various cell lines using Proteintech antibody 66402-1-Ig at a dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66402-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66402-1-Ig (TPRKB Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skin cancer using 66402-1-Ig

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66402-1-Ig (TPRKB antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Jurkat using 66402-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using TPRKB antibody (66402-1-Ig, Clone: 2D5B9 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

TPRKB Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66402-1-Ig

Clone No.2D5B9

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

2D5B9, CGI-121, EKC/KEOPS complex subunit TPRKB, My019, PRPK-binding protein

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, COLO 320 cells, Caco-2 cells, Jurkat cells, Raji cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66402-1-Ig targets TPRKB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18770

  Product name: Recombinant human TPRKB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-175 aa of BC029492

  Sequence: MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL

• Full Name: TP53RK binding protein
• Calculated Molecular Weight: 175 aa, 20 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC029492
• Gene Symbol: TPRKB
• Gene ID (NCBI): 51002
• RRID: AB_2881776
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y3C4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TPRKB, also named as CGI 121, belongs to the CGI121/TPRKB family. It interacts with TP53RK/PRPK and is widely expressed in all tissues.