TPTE Polyclonal antibody

TPTE Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 12982-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Tumor antigen BJ HCC 5, Putative tyrosine-protein phosphatase TPTE, PTEN2, EC:3.1.3.48, CT44

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HEK-293 cells, human testis tissue, BxPC-3 cells, mouse testis tissue
Positive IHC detected inhuman testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inBxPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12982-1-AP targets TPTE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3606

Product name: Recombinant human TPTE protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 209-533 aa of BC028719

Sequence: KRRYTRDGFDLDLTYVTERIIAMSFPSSGRQSFYRNPIKEVVRFLDKKHRNHYRVYNLCSERAYDPKHFHNRVVRIMIDDHNVPTLHQMVVFTKEVNEWMAQDLENIVAIHCKGGTDRTGTMVCAFLIASEICSTAKESLYYFGERRTDKTHSEKFQGVETPSQKRYVAYFAQVKHLYNWNLPPRRILFIKHFIIYSIPRYVRDLKIQIEMEKKVVFSTISLGKCSVLDNITTDKILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYLPKNELDNLHKQKARRIYPSDFAVEILFGEKMTSSDVVAGSD

Predict reactive species
Full Name transmembrane phosphatase with tensin homology
Calculated Molecular Weight 62 kDa, 64 kDa
Observed Molecular Weight 62 kDa, 64 kDa
GenBank Accession NumberBC028719
Gene Symbol TPTE
Gene ID (NCBI) 7179
RRIDAB_2206336
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP56180
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TPTE(Transmembrane phosphatase with tensin homology) is also named as CT44, BJ-HCC-5 and belongs to the non receptor class of the protein-tyrosine phosphatase family. The gene encodes a predicted polypeptide of 551 amino acids with at least 2 potential transmembrane domains and a tyrosine phosphatase motif. TPTE may be involved in the signal transduction pathways of the endocrine or spermatogenic function of the testis(PMID:10598804). It is putatively involved in linking the cell membrane to cytoskeleton. This protein is very similar in sequence to PTEN through the phosphatase and C2 domains, but lacks a PDZ binding motif and an extensively phosphorylated C-terminal tail(PMID:17240336). It has 4 isoforms produced by alternative splicing.

Protocols

Product Specific Protocols
WB protocol for TPTE antibody 12982-1-APDownload protocol
IHC protocol for TPTE antibody 12982-1-APDownload protocol
IF protocol for TPTE antibody 12982-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...