Filter: AllWB

WB analysis using 30016-1-AP (same clone as 30016-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30016-1-AP (TRA2A antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30016-1-PBS in a different storage buffer formulation.
WB analysis using 30016-1-AP (same clone as 30016-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30016-1-AP (TRA2A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30016-1-PBS in a different storage buffer formulation.

TRA2A Polyclonal antibody, PBS Only

Name: TRA2A Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 30016-1-PBS

TRA2A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30016-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

30016-1-PBS targets TRA2A in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag30841 Product name: Recombinant human TRA2A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-97 aa of BC017094 Sequence: SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSR Predict reactive species
Full Name	transformer 2 alpha homolog (Drosophila)
Calculated Molecular Weight	282 aa, 33 kDa
Observed Molecular Weight	33-35 kDa
GenBank Accession Number	BC017094
Gene Symbol	TRA2A
Gene ID (NCBI)	29896
RRID	AB_2923629
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q13595
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

TRA2A is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.

Able™