Product Information
33633-1-PBS targets TRABD in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag40480 Product name: Recombinant human TRABD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC093029 Sequence: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMKLKRRRQRPNLPRTVTQLVAEDGSRVYVVGTAHFSD Predict reactive species |
| Full Name | TraB domain containing |
| Observed Molecular Weight | 37 kDa |
| GenBank Accession Number | BC093029 |
| Gene Symbol | TRABD |
| Gene ID (NCBI) | 80305 |
| RRID | AB_3743034 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9H4I3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TraB domain-containing protein (TRABD) is also named TTG2. TRABD is a Tiki/TraB family protein that is highly expressed in the brains of patients with AD (PMID: 33446646). TRABD as a novel outer mitochondrial membrane protein. Depletion of TRABD in cells severely impairs mitochondrial respiration and ATP production, inhibits cell growth, increases reactive oxygen species levels (PMID: 40778267).



