TRAF3IP2 Polyclonal antibody

• 

  WB analysis of MCF-7 using 26692-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26692-1-AP (TRAF3IP2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 26692-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26692-1-AP (TRAF3IP2 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis of A549 using 26692-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 26692-1-AP (TRAF3IP2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 26692-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 26692-1-AP (TRAF3IP2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HepG2 using 26692-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug TRAF3IP2 Polyclonal antibody (26692-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

TRAF3IP2 Polyclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 26692-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

ACT1, Adapter protein CIKS, C6orf2, C6orf4, C6orf5

---

Tested Applications

• Positive WB detected in: MCF-7 cells, A549 cells, HepG2 cells
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 10 publications below
• IHC: See 1 publications below
• IF: See 2 publications below

Product Information

26692-1-AP targets TRAF3IP2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24840

  Product name: Recombinant human TRAF3IP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC002823

  Sequence: MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPN

• Full Name: TRAF3 interacting protein 2
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC002823
• Gene Symbol: TRAF3IP2
• Gene ID (NCBI): 10758
• RRID: AB_2880606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43734
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Oxid Med Cell Longev; Minocycline Alleviates White Matter Injury following Intracerebral Hemorrhage by Regulating CD4+ T Cell Differentiation via Notch1 Signaling Pathway.; Authors - Heng Yang
mouse	WB	Arch Toxicol; Fluoride induces apoptosis and autophagy through the IL-17 signaling pathway in mice hepatocytes.; Authors - Yangfei Zhao
mouse,human	WB	Ecotoxicol Environ Saf; Hexavalent chromium triggers hepatocytes premature senescence via the GATA4/NF-κB signaling pathway mediated by the DNA damage response.; Authors - Yu Ma
human	WB	Oxid Med Cell Longev; Prognostic Assessment of Oxidative Stress-Related Genes in Colorectal Cancer and New Insights into Tumor Immunity; Authors - Zilu Chen ; KD Validated
human	WB	Heliyon; TRAF3IP2 drives mesenchymal stem cell senescence via regulation of NAMPT-mediated NAD biosynthesis; Authors - Xiaoran Huang ; KD Validated
pig,mouse	WB	Cell Rep; Comparing HD knockin pigs and mice reveals the pathological role of IL-17; Authors - Qingqing Jia