TRAF3IP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRAF3IP2 Polyclonal antibody (26692-1-AP)

• Featured Product
• KD/KO Validated

TRAF3IP2 Polyclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 26692-1-AP Copied!

Publications (18)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), ELISA

Synonyms

ACT1, Adapter protein CIKS, C6orf2, C6orf4, C6orf5

• 

  WB analysis of MCF-7 using 26692-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 26692-1-AP (TRAF3IP2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 26692-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26692-1-AP (TRAF3IP2 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 26692-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 26692-1-AP (TRAF3IP2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 26692-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 26692-1-AP (TRAF3IP2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 26692-1-AP

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug TRAF3IP2 Polyclonal antibody (26692-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRAF3IP2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MCF-7 cells, A549 cells, HepG2 cells
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26692-1-AP targets TRAF3IP2 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24840

  Product name: Recombinant human TRAF3IP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC002823

  Sequence: MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLPGASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPN

• Full Name: TRAF3 interacting protein 2
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC002823
• Gene Symbol: TRAF3IP2
• Gene ID (NCBI): 10758
• RRID: AB_2880606
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43734
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

TRAF3IP2 Polyclonal antibody (Cat# 26692-1-AP) has 18 citations across journals including Advanced Science, Cell Reports, Archives of Toxicology, Stem Cell Research & Therapy, Journal of Ethnopharmacology, International Immunopharmacology, Oxidative Medicine and Cellular Longevity, and Heliyon. Research fields span neuroinflammation and depression, hepatotoxicity, myocardial infarction, colorectal cancer, rheumatoid arthritis, glaucoma, sarcopenia, gastric inflammation, stem cell senescence, and acute kidney injury.

Automatically generated from the 18 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Adv Sci (Weinh); Synergistic Modulation of Microglial Polarization by Acteoside and Ferulic Acid via Dual Targeting of Nrf2 and RORγt to Alleviate Depression-Associated Neuroinflammation; Authors - Dongjing Guo
mouse	WB	Arch Toxicol; Fluoride induces apoptosis and autophagy through the IL-17 signaling pathway in mice hepatocytes.; Authors - Yangfei Zhao
mouse	WB	Stem Cell Res Ther; Exosomal miR-202-5p derived from iPSC-MSCs protects against myocardial infarction through inhibition of cardiomyocyte pyroptosis; Authors - Jiaqi Chen
pig,mouse	WB	Cell Rep; Comparing HD knockin pigs and mice reveals the pathological role of IL-17; Authors - Qingqing Jia
human	WB	Oxid Med Cell Longev; Prognostic Assessment of Oxidative Stress-Related Genes in Colorectal Cancer and New Insights into Tumor Immunity; Authors - Zilu Chen ; KD Validated
pig	WB	Oxid Med Cell Longev; Minocycline Alleviates White Matter Injury following Intracerebral Hemorrhage by Regulating CD4+ T Cell Differentiation via Notch1 Signaling Pathway.; Authors - Heng Yang