DcR2 Polyclonal antibody

• 

  WB analysis using 16781-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16781-1-AP (DcR2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 16781-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16781-1-AP (DcR2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 16781-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16781-1-AP (DcR2 antibody) at dilution of 1:50 (under 40x lens).

DcR2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16781-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

CD264, Decoy receptor 2, TNF-related apoptosis-inducing ligand receptor 4, TNFRSF10D, TRAIL R4

---

Tested Applications

• Positive WB detected in: A549 cells, DU 145 cells, HeLa cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IHC: See 1 publications below

Product Information

16781-1-AP targets DcR2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10208

  Product name: Recombinant human TRAILR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 230-386 aa of BC052270

  Sequence: FSCRKKFISYLKGICSGGGGGPERVHRVLFRRRSCPSRVPGAEDNARNETLSNRYLQPTQVSEQEIQGQELAELTGVTVESPEEPQRLLEQAEAEGCQRRRLLVPVNDADSADISTLLDASATLEEGHAKETIQDQLVGSEKLFYEEDEAGSATSCL

• Full Name: tumor necrosis factor receptor superfamily, member 10d, decoy with truncated death domain
• Calculated Molecular Weight: 386 aa, 42 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC052270
• Gene Symbol: DcR2
• Gene ID (NCBI): 8793
• RRID: AB_2256181
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBN6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Decoy receptor 2 (DcR2) is a member of the tumor necrosis factor receptor (TNFR) superfamily. It functions as a decoy receptor for TNF-related apoptosis-inducing ligand (TRAIL), thereby inhibiting TRAIL-mediated apoptosis (PMID: 15538968; 9537512). It has been considered a tentative marker of cellular senescence (PMID: 16079833; 22751116). Additionally, DCR2 has been implicated in the regulation of renal fibrosis and cell senescence, contributing to the pathogenesis of diabetic nephropathy (PMID: 35661704).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mater Today Bio; Ultra-small polydopamine nanomedicine-enabled antioxidation against senescence; Authors - Jiamei Han
human	WB	Oncogene; DJ-1 inhibits TRAIL-induced apoptosis by blocking pro-caspase-8 recruitment to FADD.; Authors - Fu K K
human	WB,IHC	Sci Rep; STIM1 accelerates cell senescence in a remodeled microenvironment but enhances the epithelial-to-mesenchymal transition in prostate cancer.; Authors - Yingxi Xu