TRAIP Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TRAIP Recombinant monoclonal antibody (86808-1-RR)

• 

  WB analysis using 86808-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86808-1-RR (TRAIP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 86808-1-RR

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 86808-1-RR (TRAIP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 86808-1-RR

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 86808-1-RR (TRAIP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 86808-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86808-1-RR against Human TRAIP were performed. The affinity constant is below 1 pM.

TRAIP Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 86808-1-RR

Clone No.251370C8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

TRIP, EC:2.3.2.27, RING finger protein 206, RNF206, TRAF interacting protein

---

Tested Applications

• Positive WB detected in: HeLa cells, A549 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86808-1-RR targets TRAIP in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0491

  Product name: Recombinant human TRAIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-204 aa of BC000310

  Sequence: MPIRALCTICSDFFDHSRDVAAIHCGHTFHLQCLIQWFETAPSRTCPQCRIQVGKRTIINKLFFDLAQEEENVLDAEFLKNELDNVRAQLSQKDKEKRDSQVIIDTLRDTLEERNATVVSLQQALGKAEMLCSTLKKQMKYLEQQQDETKQAQEEARRLRSKMKTMEQIELLLQSQRPEVEEMIRDMGVGQSAVEQLAVYCVSL

• Full Name: TRAF interacting protein
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC000310
• Gene Symbol: TRAIP
• Gene ID (NCBI): 10293
• RRID: AB_3745132
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BWF2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

E3 ubiquitin-protein ligase TRAIP (TRAIP) is also named RING finger protein 206 (RNF206) and TRAF-interacting protein (TRIP). TRAIP, an E3 ligase containing a RING domain, has emerged as a significant contributor to maintaining genome integrity and TRAIP inhibits proliferation and migration of BLCA cells (PMID: 38123820). TRAIP helps replisomes overcome DNA interstrand crosslinks and DNA-protein crosslinks, whereas in mitosis it triggers disassembly of all replisomes that remain on chromatin (PMID: 33317933, PMID: 30842657).