TRAPB/SSR2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRAPB/SSR2 Polyclonal antibody, PBS Only (10278-1-PBS)

• 

  WB analysis using 10278-1-AP (same clone as 10278-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10278-1-AP (TRAPB/SSR2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10278-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10278-1-AP (same clone as 10278-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10278-1-AP (TRAPB/SSR2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10278-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10278-1-AP (same clone as 10278-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10278-1-AP (TRAPB/SSR2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10278-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 10278-1-AP (same clone as 10278-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 10278-1-AP (TRAPB/SSR2 antibody at dilution of 1:50. This data was developed using the same antibody clone with 10278-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas using 10278-1-AP (same clone as 10278-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas slide using 10278-1-AP (TRAPB/SSR2 antibody at dilution of 1:50. This data was developed using the same antibody clone with 10278-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10278-1-AP (same clone as 10278-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using TRAPB/SSR2 antibody (10278-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10278-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRAPB/SSR2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 10278-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

10278-1-PBS targets TRAPB/SSR2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0304

  Product name: Recombinant human TRAPB, SSR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-175 aa of BC000341

  Sequence: MRLLSFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKY

• Full Name: signal sequence receptor, beta (translocon-associated protein beta)
• Calculated Molecular Weight: 20 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC000341
• Gene Symbol: TRAPB
• Gene ID (NCBI): 6746
• RRID: AB_2195624
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43308
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRAPB (translocon-associated protein subunit beta), also known as SSR2 (signal sequence receptor subunit beta), is a 22-kDa single-spanning membrane glycoprotein of the endoplasmic reticulum (ER) (PMID: 7789174). It is a part of the tetrameric TRAP complex (TRAP-alpha, TRAP-beta, TRAP-delta and TRAP-gamma) which functions in regulating the retention of ER resident proteins (PMID: 7916687). The TRAP complex is also involved in endoplasmic reticulum-associated degradation (ERAD) (PMID: 17380188).