TRAPPC1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRAPPC1 Polyclonal antibody, PBS Only (19598-1-PBS)

• 

  WB analysis using 19598-1-AP (same clone as 19598-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19598-1-AP (TRAPPC1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19598-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 19598-1-AP (same clone as 19598-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13868-1-AP (TRAPPC1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19598-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 19598-1-AP (same clone as 19598-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 19598-1-AP (TRAPPC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19598-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 19598-1-AP (same clone as 19598-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 19598-1-AP (TRAPPC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19598-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 19598-1-AP (same clone as 19598-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13868-1-AP (TRAPPC1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19598-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 19598-1-AP (same clone as 19598-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13868-1-AP (TRAPPC1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19598-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 19598-1-AP (same clone as 19598-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using TRAPPC1 antibody (13868-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 19598-1-PBS in a different storage buffer formulation.

TRAPPC1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 19598-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

BET5, BET5 homolog, Multiple myeloma protein 2, MUM2, MUM-2

---

Product Information

19598-1-PBS targets TRAPPC1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5608

  Product name: Recombinant human TRAPPC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-145 aa of BC032717

  Sequence: MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG

• Full Name: trafficking protein particle complex 1
• Calculated Molecular Weight: 145 aa, 17 kDa
• Observed Molecular Weight: 15-17 kDa
• GenBank Accession Number: BC032717
• Gene Symbol: TRAPPC1
• Gene ID (NCBI): 58485
• RRID: AB_3085582
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5R8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TRAPPC1, also known as BET5 or MUM2, is a part of the multisubunit TRAPP (transport protein particle) complexes which are involved in the tethering process at different trafficking steps of vesicle transport (PMID: 16828797). TRAPPC1 may play a role in vesicular transport from the endoplasmic reticulum to Golgi (PMID: 10582700).