• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb™ PE Anti-Human TREM-1/CD354 Rabbit Recombinant Antibody

TREM-1/CD354 FcZero-rAbTM Recombinant Antibody for FC
Cat No. PE-FcA98154
Clone No.241279D10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

TREM1, CD354, TREM 1

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  PE
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman peripheral blood leukocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 μl per 10^6 cells in a 100 µl suspension or 5 μl per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

PE-FcA98154 targets TREM-1/CD354 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1438

Product name: Recombinant Human TREM-1/CD354 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 21-200 aa of NM_018643.5

Sequence: ATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRDGEMPKTLACTERPSKNSHPVQVGRIILEDYHDHGLLRVRMVNLQVEDSGLYQCVIYQPPKEPHMLFDRIRLVVTKGFSGTPGSNENSTQNVYKIPPTTTKALCPLYTSPRTVTQAPPKSTADVSTPDSEINLTNVTDIIR

Predict reactive species
Full Name triggering receptor expressed on myeloid cells 1
Calculated Molecular Weight26kDa
GenBank Accession NumberNM_018643.5
Gene Symbol TREM1
Gene ID (NCBI) 54210
Conjugate PE Fluorescent Dye
Excitation/Emission Maxima Wavelengths496 nm, 565 nm / 578 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NP99-1
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Triggering receptor expressed on myeloid cells 1 (TREM-1, also known as CD354) is a member of the immunoglobulin superfamily, which is expressed on neutrophils and monocytes. TREM1 plays a role in the innate immune system. TREM1 amplifies neutrophil and monocyte-mediated inflammatory responses triggered by bacterial and fungal infections by stimulating release of pro-inflammatory chemokines and cytokines, as well as increased surface expression of cell activation markers.

Protocols

Product Specific Protocols
FC protocol for PE TREM-1/CD354 antibody PE-FcA98154Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...