TREML4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TREML4 Polyclonal antibody, PBS Only (18056-1-PBS)

• 

  WB analysis of HL-60 using 18056-1-AP (same clone as 18056-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 18056-1-AP (TREML4 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18056-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 18056-1-AP (same clone as 18056-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 18056-1-AP (TREML4 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18056-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse thymus using 18056-1-AP (same clone as 18056-1-PBS)

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 18056-1-AP (TREML4 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18056-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 18056-1-AP (same clone as 18056-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 18056-1-AP (TREML4 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 18056-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 18056-1-AP (same clone as 18056-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 18056-1-AP (TREML4 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 18056-1-PBS in a different storage buffer formulation.

TREML4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 18056-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

18056-1-PBS targets TREML4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12574

  Product name: Recombinant human TREML4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 23-180 aa of BC101780

  Sequence: AVPEELHKHPGQTLLLQCQYSPKRGPYQPKSWCQQTSPSRCTLLVTSSKPWTAVQKSHYTIWDKPNAGFFNITMIQLTQNDSGFYWCGIYNASENIITVLRNISLVVSPAPTTSPMWTLPWLPTSTVLITSPEGTSGHPSINGSETRKSRAPACLGSG

• Full Name: triggering receptor expressed on myeloid cells-like 4
• Calculated Molecular Weight: 200 aa, 22 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC101780
• Gene Symbol: TREML4
• Gene ID (NCBI): 285852
• RRID: AB_2878488
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXN2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.