TRHDE Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRHDE Polyclonal antibody, PBS Only (21226-1-PBS)

• 

  WB analysis using 21226-1-AP (same clone as 21226-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21226-1-AP (TRHDE antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21226-1-PBS in a different storage buffer formulation.

TRHDE Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21226-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

TRH degrading ectoenzyme, TRH DE, Thyroliberinase, Pyroglutamyl peptidase II, PGPEP2

---

Product Information

21226-1-PBS targets TRHDE in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15681

  Product name: Recombinant human TRHDE protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 675-1024 aa of BC150181

  Sequence: KGSWLLGNINQTGYFRVNYDLRNWRLLIDQLIRNHEVLSVSNRAGLIDDAFSLARAGYLPQNIPLEIIRYLSEEKDFLPWHAASRALYPLDKLLDRMENYNIFNEYILKQVATTYIKLGWPKNNFNGSLVQASYQHEELRREVIMLACSFGNKHCHQQASTLISDWISSNRNRIPLNVRDIVYCTGVSLLDEDVWEFIWMKFHSTTAVSEKKILLEALTCSDDRNLLNRLLNLSLNSEVVLDQDAIDVIIHVARNPHGRDLAWKFFRDKWKILNTRYGEALFMNSKLISGVTEFLNTEGELKELKNFMKNYDGVAAASFSRAVETVEANVRWKMLYQDELFQWLGKALRH

• Full Name: thyrotropin-releasing hormone degrading enzyme
• Calculated Molecular Weight: 1024 aa, 117 kDa
• Observed Molecular Weight: 122 kDa
• GenBank Accession Number: BC150181
• Gene Symbol: TRHDE
• Gene ID (NCBI): 29953
• RRID: AB_3742022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKU6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Thyrotropin-releasing hormone-degrading ectoenzyme (TRHDE) belongs to the peptidase M1 family. TRHDE expression is detected at relatively late phases of brain development. TRHDE functions to inactivate thyrotropin-releasing hormone (PMID: 30518145, PMID: 32457627).