• Featured Product
  • KD/KO Validated

TRIB2 Polyclonal antibody

TRIB2 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 15359-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

C5FW, GS3955, TRB 2, TRB2, TRIB2, Tribbles homolog 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, mouse thymus tissue, K-562 cells
Positive IHC detected inhuman placenta tissue, human brain tissue, human heart tissue, human kidney tissue, human liver tissue, human lung tissue, human ovary tissue, human skin tissue, human spleen tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15359-1-AP targets TRIB2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7605

Product name: Recombinant human TRIB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-343 aa of BC002637

Sequence: MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

Predict reactive species
Full Name tribbles homolog 2 (Drosophila)
Calculated Molecular Weight 39 kDa
Observed Molecular Weight 46 kDa
GenBank Accession NumberBC002637
Gene Symbol TRIB2
Gene ID (NCBI) 28951
RRIDAB_2209083
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92519
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIB2, also named as TRB2 , belongs to the protein kinase superfamily, CAMK Ser/Thr protein kinase family and Tribbles subfamily. TRIB2 interacts with MAPK kinases and regulates activation of MAP kinases. It does not display kinase activity. Antibodies against TRIB2 are present in sera from patients with autoimmune uveitis(uniprot). TRIB2 is enriched in hypocretin neurons. Sera from narcolepsy patients with cataplexy had higher Trib2-specific antibody titers compared with either normal controls or patients with idiopathic hypersomnia, multiple sclerosis, or other inflammatory neurological disorders.

Protocols

Product Specific Protocols
IHC protocol for TRIB2 antibody 15359-1-APDownload protocol
WB protocol for TRIB2 antibody 15359-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IF

iScience

FUS-dependent microRNA deregulations identify TRIB2 as a druggable target for ALS motor neurons

Authors - Wan Yun Ho
mouseWB,IF

Exp Mol Med

Trib2 regulates the pluripotency of embryonic stem cells and enhances reprogramming efficiency.

Authors - Eun Kyoung Do
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...