TRIB2 Monoclonal antibody, PBS Only

• 

  WB analysis of A549 using 67171-1-Ig (same clone as 67171-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 67171-1-Ig (TRIB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67171-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-937 using 67171-1-Ig (same clone as 67171-1-PBS)

  U-937 cells were subjected to SDS PAGE followed by western blot with 67171-1-Ig (TRIB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67171-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 67171-1-Ig (same clone as 67171-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 67171-1-Ig (TRIB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67171-1-PBS in a different storage buffer formulation.

TRIB2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67171-1-PBS

Clone No.1A10A6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

1A10A6, C5FW, FLJ57420, GS3955, TRB 2

---

Product Information

67171-1-PBS targets TRIB2 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7501

  Product name: Recombinant human TRIB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-343 aa of BC002637

  Sequence: MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

• Full Name: tribbles homolog 2 (Drosophila)
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC002637
• Gene Symbol: TRIB2
• Gene ID (NCBI): 28951
• RRID: AB_2882467
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q92519
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.