TRIB2 Monoclonal antibody

TRIB2 Monoclonal Antibody for WB, ELISA
Cat No. 67171-1-Ig
Clone No.1A10A6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, CoIP, ELISA

1A10A6, C5FW, FLJ57420, GS3955, TRB 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, U-937 cells, RAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

CoIPSee 1 publications below

Product Information

67171-1-Ig targets TRIB2 in WB, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7501

Product name: Recombinant human TRIB2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-343 aa of BC002637

Sequence: MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

Predict reactive species
Full Name tribbles homolog 2 (Drosophila)
Calculated Molecular Weight 39 kDa
Observed Molecular Weight 35-40 kDa
GenBank Accession NumberBC002637
Gene Symbol TRIB2
Gene ID (NCBI) 28951
RRIDAB_2882467
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ92519
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for TRIB2 antibody 67171-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanCoIP

Structure

Nanobodies identify an activated state of the TRIB2 pseudokinase

Authors - Sam A Jamieson

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Ridhima (Verified Customer) (07-12-2021)

The antibody works well for FACS .

  • Applications: Flow Cytometry
  • Primary Antibody Dilution: 1:50
Loading...
||
New chat Able
正在加载,请稍候...