TRIB2 Monoclonal antibody

• 

  WB analysis of A549 using 67171-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 67171-1-Ig (TRIB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 67171-1-Ig

  U-937 cells were subjected to SDS PAGE followed by western blot with 67171-1-Ig (TRIB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 67171-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 67171-1-Ig (TRIB2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

TRIB2 Monoclonal Antibody for WB, ELISA

Cat No. 67171-1-Ig

Clone No.1A10A6

Publications(1)

Reviews (1)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, CoIP, ELISA

Synonyms

1A10A6, C5FW, FLJ57420, GS3955, TRB 2

---

Tested Applications

• Positive WB detected in: A549 cells, U-937 cells, RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• CoIP: See 1 publications below

Product Information

67171-1-Ig targets TRIB2 in WB, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7501

  Product name: Recombinant human TRIB2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-343 aa of BC002637

  Sequence: MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN

• Full Name: tribbles homolog 2 (Drosophila)
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC002637
• Gene Symbol: TRIB2
• Gene ID (NCBI): 28951
• RRID: AB_2882467
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q92519
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	CoIP	Structure; Nanobodies identify an activated state of the TRIB2 pseudokinase; Authors - Sam A Jamieson

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Ridhima (Verified Customer) (07-12-2021)

The antibody works well for FACS .

• Applications: Flow Cytometry
• Primary Antibody Dilution: 1:50