CoraLite® Plus 488-conjugated TRIM15 Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL488-83582-5

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CoraLite® Plus 488 TRIM15 antibody (CL488-83582-5, Clone: 240565C7 ) at dilution of 1:200, CL594-Phalloidin (red).

TRIM15 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83582-5

Clone No.240565C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

RNF93, TRIM, RING finger protein 93, EC:2.3.2.27, E3 ubiquitin-protein ligase TRIM15

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83582-5 targets TRIM15 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4533

  Product name: Recombinant human TRIM15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-270 aa of BC038585

  Sequence: MPATPSLKVVHELPACTLCAGPLEDAVTIPCGHTFCRLCLPALSQMGAQSSGKILLCPLCQEEEQAETPMAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLDEAIQPYRDRLRSRLEALSTERDEIEDVKCQEDQKLQVLLTQIESKKHQVETAFERLQQELEQQRCLLLARLRELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQDVRVNQSRCEMKTFVSPEAISPDLVKKIRDFHRK

• Full Name: tripartite motif-containing 15
• Calculated Molecular Weight: 465 aa, 52 kDa
• GenBank Accession Number: BC038585
• Gene Symbol: TRIM15
• Gene ID (NCBI): 89870
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9C019
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

TRIM15 (Tripartite motif-containing protein 15) is also named as RNF93, ZNF178, ZNFB7 and belongs to the TRIM/RBCC family. It acts as an ubiquitin-protein ligase and contributes to the endogenous restriction of retroviruses in cells.