TRIM23 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TRIM23 Polyclonal antibody, PBS Only (12607-1-PBS)

• 

  WB analysis of HEK-293 using 12607-1-AP (same clone as 12607-1-PBS)

  WB result of TRIM23 antibody (12607-1-AP; 1:800; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRIM23 transfected HEK-293 cells. This data was developed using the same antibody clone with 12607-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 12607-1-AP (same clone as 12607-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12607-1-AP (TRIM23 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12607-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 12607-1-AP (same clone as 12607-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12607-1-AP (TRIM23 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12607-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12607-1-AP (same clone as 12607-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 12607-1-AP (TRIM23 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12607-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRIM23 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 12607-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

12607-1-PBS targets TRIM23 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3302

  Product name: Recombinant human TRIM23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 275-574 aa of BC022510

  Sequence: EHVPGTAENARSCIRAYFYDLHETLCRQEEMALSVVDAHVREKLIWLRQQQEDMTILLSEVSAACLHCEKTLQQDDCRVVLAKQEITRLLETLQKQQQQFTEVADHIQLDASIPVTFTKDNRVHIGPKMEIRVVTLGLDGAGKTTILFKLKQDEFMQPIPTIGFNVETVEYKNLKFTIWDVGGKHKLRPLWKHYYLNTQAVVFVVDSSHRDRISEAHSELAKLLTEKELRDALLLIFANKQDVAGALSVEEITELLSLHKLCCGRSWYIQGCDARSGMGLYEGLDWLSRQLVAAGVLDVA

• Full Name: tripartite motif-containing 23
• Calculated Molecular Weight: 574 aa, 64 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC022510
• Gene Symbol: TRIM23
• Gene ID (NCBI): 373
• RRID: AB_2256643
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36406
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.